-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human SHC4 (NP_976224.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SHC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human SHC4 (NP_976224.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06836A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHC4 |
| Target Synonyms | RaLP; SHCD; SHC4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human SHC4 (NP_976224.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPHPALAPHLPTEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHL | Uniprot ID | Q6S5L8 |
Uniprot Id
Q6S5L8
Target Species
Human
Target Name
SHC4
Target Full Name
SHC-transforming protein 4
Target Function
Activates both Ras-dependent and Ras-independent migratory pathways in melanomas. Contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane.
Target Tissue Specificity
Only expressed in melanomas. Weakly expressed in normal melanocytes and benign nevi. Highly expressed at the transition from radial growth phase to vertical growth phase and metastatic melanomas, when tumor cells acquire migratory competence and invasive
Target Synonyms
hShcD; MGC34023; Rai like protein; Rai-like protein; RaLP; SH2 domain protein C4; SHC (Src homology 2 domain containing) family member 4; SHC 4; SHC adaptor protein 4; SHC; SHC family member 4; SHC transforming protein 4; SHC transforming protein D; SHC-transforming protein 4; SHC-transforming protein D; Shc4; SHC4_HUMAN; SHCD; Src homology 2 domain containing family member 4; Src homology 2 domain containing transforming protein C4; Src homology 2 domain-containing-transforming protein C4
Target Background
Predicted to enable receptor tyrosine kinase binding activity. Predicted to be involved in transmembrane receptor protein tyrosine kinase signaling pathway. Predicted to act upstream of or within several processes, including apoptotic process; positive regulation of cell population proliferation; and stem cell differentiation. Predicted to be located in postsynaptic membrane. Predicted to be active in plasma membrane.
Notification