Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MOBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MOBP (NP_891980.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MOBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MOBP (NP_891980.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10456A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MOBP |
| Target Synonyms | MOBP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MOBP (NP_891980.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL | Uniprot ID | Q13875 |
Uniprot Id
Q13875
Target Species
Human
Target Name
MOBP
Target Full Name
Myelin-associated oligodendrocyte basic protein
Target Function
May play a role in compacting or stabilizing the myelin sheath, possibly by binding the negatively charged acidic phospholipids of the cytoplasmic membrane.
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Synonyms
MOBP; Myelin-associated oligodendrocyte basic protein
Target Background
Predicted to enable actin binding activity and myosin binding activity. Predicted to be a structural constituent of myelin sheath. Predicted to be involved in nervous system development. Predicted to be located in mitochondrion. Predicted to be active in cortical actin cytoskeleton. Implicated in frontotemporal dementia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
