Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COL10A1 was raised in Rabbit using the recombinant protein of human COL10A1 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COL10A1 was raised in Rabbit using the recombinant protein of human COL10A1 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of HT-1080, using COL10A1 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.
| Cat.No | ADA-10661A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COL10A1 |
| Target Synonyms | COL10A1; collagen alpha-1(X) chain | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-1080 | Application | ELISA, WB |
| Immunogen Description | Recombinant protein of human COL10A1. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM | Uniprot ID | Q03692 |
Uniprot Id
Q03692
Target Species
Human
Target Name
COL10A1
Target Full Name
Collagen alpha-1(X) chain
Target Function
Type X collagen is a product of hypertrophic chondrocytes and has been localized to presumptive mineralization zones of hyaline cartilage.
Target Involvement
Schmid type metaphyseal chondrodysplasia (SMCD)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Synonyms
COL10A1; collagen alpha-1(X) chain
Target Background
This gene encodes the alpha chain of type X collagen, a short chain collagen expressed by hypertrophic chondrocytes during endochondral ossification. Unlike type VIII collagen, the other short chain collagen, type X collagen is a homotrimer. Mutations in this gene are associated with Schmid type metaphyseal chondrodysplasia (SMCD) and Japanese type spondylometaphyseal dysplasia (SMD).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
