Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human TFF3 (NP_003217.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TFF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human TFF3 (NP_003217.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Immunofluorescence analysis of human colon carcinoma using TFF3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Cat.No | ADA-11323A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFF3 |
| Target Synonyms | ITF; P1B; TFI; TFF3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human TFF3 (NP_003217.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF | Uniprot ID | Q07654 |
Uniprot Id
Q07654
Target Species
Human
Target Name
TFF3
Target Full Name
Trefoil factor 3
Target Function
Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Cytoplasm.
Target Tissue Specificity
Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular
Target Research Area
Signal Transduction
Target Synonyms
hITF; hP1.B; Intestinal trefoil factor; ITF; mITF; OTTMUSP00000021729; P1B; Polypeptide P1.B; TFF3; TFF3_HUMAN; TFI; TREFOIL; Trefoil factor (intestinal); Trefoil factor 3
Target Background
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
