Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DREB1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana DREB1B (NP_567721.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DREB1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana DREB1B (NP_567721.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07921A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DREB1B |
| Target Synonyms | ATCBF1; C-repeat/DRE binding factor 1; DRE BINDING PROTEIN 1B; DREB1B; T30C3.11; TRANSCRIPTIONAL ACTIVATOR CBF1 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Inflorescences, Seedling | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana DREB1B (NP_567721.1). | Immunogen Sequence | GVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFADSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTNHGLDMEE |
|---|---|---|---|
| Uniprot ID | P93835 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
