-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACADL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-210 of human ACADL (NP_001599.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ACADL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-210 of human ACADL (NP_001599.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12118A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACADL |
| Target Synonyms | LCAD; ACAD4; ACADL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse liver, Rat spinal cord, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-210 of human ACADL (NP_001599.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGEERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGGIGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIPQMTAGKCIGAIAMTEPGAGSDLQGIKTNAKKDGSDWILNGSKVFISNGSLS | Uniprot ID | P28330 |
Uniprot Id
P28330
Target Species
Human
Target Name
ACADL
Target Full Name
Long-chain specific acyl-CoA dehydrogenase, mitochondrial
Target Function
Long-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats. The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA. Among the different mitochondrial acyl-CoA dehydrogenases, long-chain specific acyl-CoA dehydrogenase can act on saturated and unsaturated acyl-CoAs with 6 to 24 carbons with a preference for 8 to 18 carbons long primary chains.
Target Involvement
Acyl-CoA dehydrogenase very long-chain deficiency (ACADVLD)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Acyl-CoA dehydrogenase family
Target Synonyms
ACAD4; ACADL; ACADL_HUMAN; Acyl Coenzyme A dehydrogenase long chain; Acyl-CoA dehydrogenase long chain; FLJ94052; LCAD; Long chain acyl CoA dehydrogenase; Long-chain specific acyl-CoA dehydrogenase; mitochondrial
Target Background
The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
Notification