-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Activator protein 2 (AP-2/TFAP2A) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Activator protein 2 (AP-2/TFAP2A) (NP_003211.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Activator protein 2 (AP-2/TFAP2A) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Activator protein 2 (AP-2/TFAP2A) (NP_003211.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07836A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Activator protein 2 (AP-2/TFAP2A) |
| Target Synonyms | AP-2; BOFS; AP2TF; TFAP2; AP-2alpha; Activator protein 2 (AP-2/TFAP2A) | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Activator protein 2 (AP-2/TFAP2A) (NP_003211.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNL | Uniprot ID | P05549 |
Uniprot Id
P05549
Target Species
Human
Target Name
TFAP2A
Target Full Name
Transcription factor AP-2-alpha
Target Function
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.
Target Involvement
Branchiooculofacial syndrome (BOFS)
Target Subcellular Location
Nucleus.
Target Protein Families
AP-2 family
Target Synonyms
Activating enhancer binding protein 2 alpha; Activating enhancer-binding protein 2-alpha; Activator protein 2; AP 2 transcription factor; AP 2alpha; AP-2; AP-2 transcription factor; AP2; AP2 Transcription Factor; AP2-alpha; AP2A_HUMAN; AP2TF; BOFS; FLJ51761; TFAP 2; TFAP 2A; TFAP2; TFAP2A; Transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); Transcription factor AP-2-alpha; Transcription factor AP2 alpha
Target Background
The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.
Notification