Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALPI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human ALPI (NP_001622.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALPI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human ALPI (NP_001622.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with ALPI using ALPI Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10 s.
| Cat.No | ADA-11805A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALPI |
| Target Synonyms | IAP; ALPI | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F transfected with ALPI, Mouse small intestine | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human ALPI (NP_001622.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQE | Uniprot ID | P09923 |
Uniprot Id
P09923
Target Species
Human
Target Name
ALPI
Target Full Name
Intestinal-type alkaline phosphatase
Target Function
Alkaline phosphatase that can hydrolyze various phosphate compounds.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Alkaline phosphatase family
Target Research Area
Signal Transduction
Target Synonyms
Alkaline phosphatase intestinal; Alkaline phosphomonoesterase; Alpi; Glycerophosphatase; IAP; Intestinal alkaline phosphatase; Intestinal-type alkaline phosphatase; Kasahara isozyme; OTTHUMP00000164357; PPBI_HUMAN
Target Background
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
