Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Apolipoprotein A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A2 (NP_001634.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Apolipoprotein A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A2 (NP_001634.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00628A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Apolipoprotein A2 |
| Target Synonyms | apoAII; Apo-AII; ApoA-II; Apolipoprotein A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A2 (NP_001634.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ | Uniprot ID | P02652 |
Uniprot Id
P02652
Target Species
Human
Target Name
APOA2
Target Full Name
Apolipoprotein A-II
Target Function
May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
Target Subcellular Location
Secreted.
Target Protein Families
Apolipoprotein A2 family
Target Tissue Specificity
Plasma; synthesized in the liver and intestine.
Target Research Area
Cancer
Target Synonyms
APO A2; Apo AII; Apo-AII; APOA 2; ApoA II; ApoA-II; APOA2; APOA2_HUMAN; APOAII; Apolipoprotein A II; Apolipoprotein A-II(1-76); Apolipoprotein A2; Apolipoprotein AII; ApolipoproteinA II; OTTHUMP00000032244
Target Background
This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
