-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ApoM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-188 of human ApoM (NP_061974.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ApoM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-188 of human ApoM (NP_061974.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10803A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOM |
| Target Synonyms | G3a; NG20; apo-M; HSPC336; ApoM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, human serum | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-188 of human ApoM (NP_061974.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN | Uniprot ID | O95445 |
Uniprot Id
O95445
Target Species
Human
Target Name
APOM
Target Full Name
Apolipoprotein M
Target Function
Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid.
Target Subcellular Location
Secreted. Note=Present in high density lipoprotein (HDL) and to a lesser extent in triglyceride-rich lipoproteins (TGRLP) and low density lipoproteins (LDL).
Target Protein Families
Calycin superfamily, Lipocalin family
Target Tissue Specificity
Plasma protein. Expressed in liver and kidney.
Target Research Area
Signal Transduction
Target Synonyms
Apo M; Apo-M; Apolipoprotein M; ApoM; APOM_HUMAN; G3A; HSPC336; MGC22400; NG20; NG20 like protein; Protein G3a
Target Background
The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene.
Notification