-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP6V1G3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATP6V1G3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05638A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP6V1G3 |
| Target Synonyms | Vma10; ATP6G3; ATP6V1G3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN | Uniprot ID | Q96LB4 |
Uniprot Id
Q96LB4
Target Species
Human
Target Name
ATP6V1G3
Target Full Name
V-type proton ATPase subunit G 3
Target Function
Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Target Protein Families
V-ATPase G subunit family
Target Tissue Specificity
Kidney.
Target Synonyms
ATP6G3; atp6v1g3; ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3; MGC119810; MGC119813; MGC130213; MGC130214; V ATPase 13 kDa subunit 3; V ATPase G subunit 3; V ATPase G3 subunit; V ATPase subunit G 3; V-ATPase 13 kDa subunit 3; V-ATPase subunit G 3; V-type proton ATPase subunit G 3; Vacuolar ATP synthase subunit G 3; Vacuolar proton pump G subunit 3; Vacuolar proton pump subunit G 3; Vacuolar proton pump, subunit G3; VATG3_HUMAN; Vma10
Target Background
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene.
Notification