-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bad was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Bad (NP_004313.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Bad was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Bad (NP_004313.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12471A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAD |
| Target Synonyms | BBC2; BCL2L8; Bad | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Bad (NP_004313.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV | Uniprot ID | Q92934 |
Uniprot Id
Q92934
Target Species
Human
Target Name
BAD
Target Full Name
Bcl2-associated agonist of cell death
Target Function
Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2. Appears to act as a link between growth factor receptor signaling and the apoptotic pathways.
Target Subcellular Location
Mitochondrion outer membrane. Cytoplasm.
Target Protein Families
Bcl-2 family
Target Tissue Specificity
Expressed in a wide variety of tissues.
Target Synonyms
AI325008; BAD; BAD_HUMAN; BBC 2; BBC2; BBC6; Bcl 2 Antagonist of Cell Death; Bcl 2 Binding Component 6; BCL X / BCL 2 Binding Protein; BCL X Binding Protein; Bcl XL/Bcl 2 Associated Death Promoter; Bcl-2-binding component 6; Bcl-2-like protein 8; Bcl-XL/Bcl-2-associated death promoter; Bcl2 antagonist of cell death; BCL2 antagonist of cell death protein; BCL2 associated agonist of cell death; Bcl2 Associated Death Promoter; BCL2 binding component 6; BCL2 binding protein; Bcl2 Like 8 Protein; Bcl2-L-8; BCL2L8; Proapoptotic BH3 Only Protein
Target Background
The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.
Notification