Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calponin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-297 of human Calponin (NP_001290.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Calponin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-297 of human Calponin (NP_001290.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10451A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calponin |
| Target Synonyms | SMCC; Sm-Calp; HEL-S-14; Calponin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse large intestine, Mouse stomach, Rat lung, Rat stomach, Rat uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-297 of human Calponin (NP_001290.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA | Uniprot ID | P51911 |
Uniprot Id
P51911
Target Species
Human
Target Name
CNN1
Target Full Name
Calponin-1
Target Function
Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
Target Protein Families
Calponin family
Target Tissue Specificity
Smooth muscle, and tissues containing significant amounts of smooth muscle.
Target Research Area
Cardiovascular
Target Synonyms
Basic calponin; Calponin 1; Calponin 1 basic smooth muscle; Calponin H1; Calponin H1 smooth muscle; Calponin-1; Calponin1; Calponins basic; CNN 1; Cnn1; CNN1_HUMAN; Epididymis secretory protein Li 14; HEL S 14; Sm Calp; SMCC; smooth muscle
Target Background
Predicted to enable actin binding activity. Involved in negative regulation of vascular associated smooth muscle cell proliferation. Located in cytoskeleton.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
