-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAMK2G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CAMK2G (NP_751909.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CAMK2G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CAMK2G (NP_751909.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07813A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAMK2G |
| Target Synonyms | CAMK; CAMKG; MRD59; CAMK-II; CAMK2G | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, 22Rv1, HL-60, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CAMK2G (NP_751909.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAI | Uniprot ID | Q13555 |
Uniprot Id
Q13555
Target Species
Human
Target Name
CAMK2G
Target Full Name
Calcium/calmodulin-dependent protein kinase type II subunit gamma
Target Function
Calcium/calmodulin-dependent protein kinase that functions autonomously after Ca(2+)/calmodulin-binding and autophosphorylation, and is involved in sarcoplasmic reticulum Ca(2+) transport in skeletal muscle and may function in dendritic spine and synapse formation and neuronal plasticity. In slow-twitch muscles, is involved in regulation of sarcoplasmic reticulum (SR) Ca(2+) transport and in fast-twitch muscle participates in the control of Ca(2+) release from the SR through phosphorylation of the ryanodine receptor-coupling factor triadin. In the central nervous system, it is involved in the regulation of neurite formation and arborization. It may participate in the promotion of dendritic spine and synapse formation and maintenance of synaptic plasticity which enables long-term potentiation (LTP) and hippocampus-dependent learning.
Target Subcellular Location
Sarcoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Target Tissue Specificity
Expressed in skeletal muscle.
Target Synonyms
CAMK2G; CAMK; CAMK-II; CAMKGCalcium/calmodulin-dependent protein kinase type II subunit gamma; CaM kinase II subunit gamma; CaMK-II subunit gamma; EC 2.7.11.17
Target Background
The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined.
Notification