Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CARTPT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CARTPT (NP_004282.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against CARTPT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CARTPT (NP_004282.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of CARTPT in paraffin-embedded rat brain using CARTPT Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-00793A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CARTPT |
| Target Synonyms | CART; CARTPT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CARTPT (NP_004282.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLC | Uniprot ID | Q16568 |
Uniprot Id
Q16568
Target Species
Human
Target Name
CARTPT
Target Full Name
Cocaine- and amphetamine-regulated transcript protein
Target Function
Satiety factor closely associated with the actions of leptin and neuropeptide Y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
Target Subcellular Location
Secreted.
Target Protein Families
CART family
Target Tissue Specificity
Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus.
Target Synonyms
CART; CART prepropeptide; CART(42-89); CART_HUMAN; Cartpt; Cocaine and amphetamine regulated transcript
Target Background
This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
