-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CBX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CBX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00522A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CBX1 |
| Target Synonyms | CBX; M31; MOD1; p25beta; HP1-BETA; HP1Hsbeta; HP1Hs-beta; CBX1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | OVCAR3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP | Uniprot ID | P83916 |
Uniprot Id
P83916
Target Species
Human
Target Name
CBX1
Target Full Name
Chromobox protein homolog 1
Target Function
Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
Target Subcellular Location
Nucleus. Note=Unassociated with chromosomes during mitosis.
Target Tissue Specificity
Expressed in all adult and embryonic tissues.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CBX 1; CBX; Cbx1; CBX1_HUMAN; Chromobox 1; Chromobox homolog 1 (HP1 beta homolog Drosophila ); chromobox homolog 1; Chromobox protein homolog 1; Drosophila HP1 beta; Heterochromatin protein 1 beta; Heterochromatin protein 1 homolog beta; Heterochromatin protein p25; heterochromatin protein p25 beta; HP1 beta; HP1 beta homolog; HP1 beta homolog Drosophila; HP1; Drosophila. homolog of; beta; HP1beta; HP1Hs beta; HP1Hsbeta; Human heterochromatin protein p25 mRNA complete cds; M31; MOD 1; MOD1; Modifier 1 protein; p25beta
Target Background
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification