-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 708-847 of human CD22 (NP_001762.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 708-847 of human CD22 (NP_001762.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03670A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD22 |
| Target Synonyms | SIGLEC2; SIGLEC-2; CD22 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, Raji, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 708-847 of human CD22 (NP_001762.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVILKH | Uniprot ID | P20273 |
Uniprot Id
P20273
Target Species
Human
Target Name
CD22
Target Full Name
B-cell receptor CD22
Target Function
Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family
Target Tissue Specificity
B-lymphocytes.
Target Research Area
Immunology
Target Synonyms
B cell receptor CD22 precursor; B lymphocyte cell adhesion molecule; B-cell receptor CD22; B-lymphocyte cell adhesion molecule; BL CAM; BL-CAM; BLCAM; CD 22; CD22; CD22 antigen; CD22 molecule; CD22 protein; CD22_HUMAN; Lectin 2; Leu14; Lyb8; MGC130020; sialic acid binding Ig like lectin 2; Sialic acid binding immunoglobulin like lectin 2; Sialic acid-binding Ig-like lectin 2; SIGLEC 2; Siglec-2; SIGLEC2; T cell surface antigen Leu 14; T-cell surface antigen Leu-14
Target Background
Predicted to enable CD4 receptor binding activity; protein phosphatase binding activity; and sialic acid binding activity. Involved in B cell activation; negative regulation of B cell receptor signaling pathway; and regulation of endocytosis. Located in early endosome and recycling endosome.
Notification