-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHST15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 452-561 of human CHST15 (NP_056976.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHST15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 452-561 of human CHST15 (NP_056976.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01071A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHST15 |
| Target Synonyms | BRAG; GALNAC4S-6ST; CHST15 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 452-561 of human CHST15 (NP_056976.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT | Uniprot ID | Q7LFX5 |
Uniprot Id
Q7LFX5
Target Species
Human
Target Name
CHST15
Target Full Name
Carbohydrate sulfotransferase 15
Target Function
Sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. May also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein. Note=A small fraction may also be present at the cell surface, where it acts as a B-cell receptor.
Target Protein Families
Sulfotransferase 1 family
Target Tissue Specificity
Expressed in B-cell-enriched tissues but not in fetal or adult thymus. Expressed in fetal and adult spleen, lymph node, tonsil, bone marrow and peripheral leukocytes. Not expressed in T-cells. In pro-B, pre-B, and mature B-cell lines, it colocalizes with
Target Synonyms
B cell RAG associated gene protein; B cell RAG associated protein; B-cell RAG-associated gene protein; BRAG; Carbohydrate sulfotransferase 15; Chst15; CHSTF_HUMAN; GALNAC4S 6ST; GalNAc4S-6ST; hBRAG; KIAA0598; N acetylgalactosamine 4 sulfate 6 O sulfotransferase; N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase; ST4S6
Notification