Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CITED2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CITED2(NP_001161860.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CITED2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CITED2(NP_001161860.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Rat testis, using CITED2 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-08288A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CITED2 |
| Target Synonyms | ASD8; MRG1; VSD2; MRG-1; P35SRJ; CITED2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CITED2(NP_001161860.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMG | Uniprot ID | Q99967 |
Uniprot Id
Q99967
Target Species
Human
Target Name
CITED2
Target Full Name
Cbp/p300-interacting transactivator 2
Target Function
Transcriptional coactivator of the p300/CBP-mediated transcription complex. Acts as a bridge, linking TFAP2 transcription factors and the p300/CBP transcriptional coactivator complex in order to stimulate TFAP2-mediated transcriptional activation. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Stimulates the peroxisome proliferator-activated receptors PPARA transcriptional activity. Enhances estrogen-dependent transactivation mediated by estrogen receptors. Acts also as a transcriptional corepressor; interferes with the binding of the transcription factors HIF1A or STAT2 and the p300/CBP transcriptional coactivator complex. Participates in sex determination and early gonad development by stimulating transcription activation of SRY. Plays a role in controlling left-right patterning during embryogenesis; potentiates transcriptional activation of NODAL-mediated gene transcription in the left lateral plate mesoderm (LPM). Plays an essential role in differentiation of the adrenal cortex from the adrenogonadal primordium (AGP); stimulates WT1-mediated transcription activation thereby up-regulating the nuclear hormone receptor NR5A1 promoter activity. Associates with chromatin to the PITX2 P1 promoter region.
Target Involvement
Ventricular septal defect 2 (VSD2); Atrial septal defect 8 (ASD8)
Target Subcellular Location
Nucleus. Note=Colocalizes with EP300 in dot-like structures.
Target Protein Families
CITED family
Target Synonyms
ASD8; Cbp/p300 interacting transactivator 2; Cbp/p300 interacting transactivator with Glu/Asp rich carboxy terminal domain 2; Cbp/p300-interacting transactivator 2; CITE2_HUMAN; CITED 2; CITED2; melanocyte-specific gene 1-related gene 1; MRG 1; MRG-1; MRG1; MSG related protein 1; MSG-related protein 1; MSG1-related gene 1; P35srj; VSD2
Target Background
The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
