Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLEC3B/Tetranectin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human CLEC3B/Tetranectin (NP_003269.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against CLEC3B/Tetranectin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human CLEC3B/Tetranectin (NP_003269.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of HeLa cells using CLEC3B/Tetranectin antibody. Blue: DAPI for nuclear staining.
| Cat.No | ADA-03038A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLEC3B/Tetranectin |
| Target Synonyms | TN; TNA; MCDR4; CLEC3B/Tetranectin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human CLEC3B/Tetranectin (NP_003269.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV | Uniprot ID | P05452 |
Uniprot Id
P05452
Target Species
Human
Target Name
CLEC3B
Target Full Name
Tetranectin
Target Function
Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Found in plasma.
Target Research Area
Cardiovascular
Target Synonyms
C type lectin domain family 3 member B; C-type lectin domain family 3 member B; Clec3b; Plasminogen kringle 4 binding protein; Plasminogen kringle 4-binding protein; TETN_HUMAN; Tetranectin (plasminogen binding protein); Tetranectin; TN; TNA
Target Background
Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
