-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLPX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human CLPX (NP_006651.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLPX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human CLPX (NP_006651.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00646A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLPX |
| Target Synonyms | EPP2; CLPX | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat live | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human CLPX (NP_006651.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEP | Uniprot ID | O76031 |
Uniprot Id
O76031
Target Species
Human
Target Name
CLPX
Target Full Name
ATP-dependent clpX-like chaperone, mitochondrial
Target Function
ATP-dependent specificity component of the Clp protease complex. Hydrolyzes ATP. Targets specific substrates for degradation by the Clp complex. Can perform chaperone functions in the absence of CLPP. Enhances the DNA-binding activity of TFAM and is required for maintaining a normal mitochondrial nucleoid structure. ATP-dependent unfoldase that stimulates the incorporation of the pyridoxal phosphate cofactor into 5-aminolevulinate synthase, thereby activating 5-aminolevulinate (ALA) synthesis, the first step in heme biosynthesis. Important for efficient erythropoiesis through upregulation of heme biosynthesis
Target Subcellular Location
Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid.
Target Protein Families
ClpX chaperone family
Target Tissue Specificity
Higher expression in skeletal muscle and heart and to a lesser extent in liver, brain, placenta, lung, kidney and pancreas.
Target Synonyms
ATP dependent Clp protease ATP binding subunit clpX like; mitochondrial; ATP-dependent Clp protease ATP-binding subunit clpX-like; mitochondrial; AU014732; Caseinolytic mitochondrial matrix peptidase chaperone subunit; Caseinolytic peptidase X (E.coli); Caseinolytic protease X; clpX; ClpX caseinolytic peptidase X homolog; ClpX caseinolytic protease X homolog; CLPX_HUMAN; E330029I21; Energy dependent regulator of proteolysis
Notification