-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRNN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRNN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01112A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRNN |
| Target Synonyms | DRC1; PDRC1; SEP53; C1orf10; CRNN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GETVPGGQAQTGASTESGRQEWSSTHPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYLRSTKP | Uniprot ID | Q9UBG3 |
Uniprot Id
Q9UBG3
Target Species
Human
Target Name
CRNN
Target Full Name
Cornulin
Target Function
Promotes cell proliferation, G1/S cell cycle progression and induces expression of the cell cycle regulator CCND1. Regulates proliferation induced by proinflammatory cytokine response via activation of NFKB1 and PI3K/AKT signaling pathways.
Target Subcellular Location
Cytoplasm. Note=Does not colocalize with TGM1.
Target Protein Families
S100-fused protein family
Target Tissue Specificity
Expressed in the basal skin layer (at protein level). Squamous epithelia cell-specific. Expressed in the esophagus (periphery of the cells of the granular and the upper spinous layers), foreskin (granular and lower cornified cells), scalp skin (granular l
Target Synonyms
53 kDa putative calcium binding protein; 53 kDa putative calcium-binding protein; 53 kDa squamous epithelial induced stress protein; 53 kDa squamous epithelial-induced stress protein; 58 kDa heat shock protein; C1orf10; Chromosome 1 open reading frame 10; Cornulin; CRNN; CRNN_HUMAN; DRC1; PDRC1; SEP53; Squamous epithelial heat shock protein 53; Tumor related protein; Tumor-related protein
Target Background
This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
Notification