Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-150 of human Cyclin L2 (NP_001307082.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cyclin L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-150 of human Cyclin L2 (NP_001307082.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10157A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin L2 |
| Target Synonyms | CCNM; CCNS; PCEE; SB138; ANIA-6B; HLA-ISO; HCLA-ISO; Cyclin L2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A375, Jurkat, LO2, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-150 of human Cyclin L2 (NP_001307082.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLYARKKVDLTHLEGEVEKRKHAIEEAKAQARGLLPGGTQVLDGTSGFSPAPKLVESPKEGKGSKPSPLSVKNTKRRLEGAKKAKADSPVN | Uniprot ID | Q96S94 |
Uniprot Id
Q96S94
Target Species
Human
Target Name
CCNL2
Target Full Name
Cyclin-L2
Target Function
Involved in pre-mRNA splicing. May induce cell death, possibly by acting on the transcription and RNA processing of apoptosis-related factors.
Target Subcellular Location
Nucleus speckle. Nucleus, nucleoplasm.
Target Protein Families
Cyclin family, Cyclin L subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
CCNL2; SB138Cyclin-L2; Paneth cell-enhanced expression protein
Target Background
The protein encoded by this gene belongs to the cyclin family. Through its interaction with several proteins, such as RNA polymerase II, splicing factors, and cyclin-dependent kinases, this protein functions as a regulator of the pre-mRNA splicing process, as well as in inducing apoptosis by modulating the expression of apoptotic and antiapoptotic proteins. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
