Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human DDT (NP_001346.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DDT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human DDT (NP_001346.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01099A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDT |
| Target Synonyms | D-DT; DDCT; MIF2; MIF-2; DDT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human DDT (NP_001346.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL | Uniprot ID | P30046 |
Uniprot Id
P30046
Target Species
Human
Target Name
DDT
Target Full Name
D-dopachrome decarboxylase
Target Function
Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
Target Subcellular Location
Cytoplasm.
Target Protein Families
MIF family
Target Synonyms
D dopachrome decarboxylase; D dopachrome tautomerase; D-dopachrome decarboxylase; D-dopachrome tautomerase; DDCT; Ddt; DOPD_HUMAN; Phenylpyruvate tautomerase II
Target Background
D-dopachrome tautomerase converts D-dopachrome into 5, 6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
