-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Desmocollin 3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 576-690 of human Desmocollin 3 (NP_001932.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Desmocollin 3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 576-690 of human Desmocollin 3 (NP_001932.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07994A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Desmocollin 3 |
| Target Synonyms | DSC; DSC1; DSC2; DSC4; CDHF3; HT-CP; Desmocollin 3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 576-690 of human Desmocollin 3 (NP_001932.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EILQEYVVICKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRSTGVILGK | Uniprot ID | Q14574 |
Uniprot Id
Q14574
Target Species
Human
Target Name
DSC3
Target Full Name
Desmocollin-3
Target Function
Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. May contribute to epidermal cell positioning (stratification) by mediating differential adhesiveness between cells that express different isoforms.
Target Involvement
Hypotrichosis and recurrent skin vesicles (HRSV)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, desmosome.
Target Tissue Specificity
Epidermis, buccal mucosa, esophagus and cervix.
Target Synonyms
Cadherin family member 3; CDHF3; desmocollin 3a/3b; Desmocollin 4; Desmocollin-3; Desmocollin-4; Desmocollin3; Desmocollin4; DSC; DSC1; DSC2; DSC3; DSC3_HUMAN; DSC4; HT CP; HT-CP; HTCP
Target Background
The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Mutations in this gene are a cause of hypotrichosis and recurrent skin vesicles disorder. The protein can act as an autoantigen in pemphigus diseases, and it is also considered to be a biomarker for some cancers. Alternative splicing of this gene results in multiple transcript variants.
Notification