-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against E2F5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 197-346 of human E2F5 (NP_001942.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against E2F5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 197-346 of human E2F5 (NP_001942.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04674A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | E2F5 |
| Target Synonyms | E2F-5; E2F5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 197-346 of human E2F5 (NP_001942.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY | Uniprot ID | Q15329 |
Uniprot Id
Q15329
Target Species
Human
Target Name
E2F5
Target Full Name
Transcription factor E2F5
Target Function
Transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. May mediate growth factor-initiated signal transduction. It is likely involved in the early responses of resting cells to growth factor stimulation. Specifically required for multiciliate cell differentiation: together with MCIDAS and E2F5, binds and activate genes required for centriole biogenesis.
Target Subcellular Location
Nucleus.
Target Protein Families
E2F/DP family
Target Synonyms
E2F 5; E2F transcription factor 5; E2F transcription factor 5 p130 binding; E2F-5; E2f5; E2F5_HUMAN; p130 binding; Transcription factor E2F5
Target Background
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionarily conserved domains that are present in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It has higher identity to E2F4 than to other family members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB. Alternative splicing results in multiple variants encoding different isoforms.
Notification