Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EDNRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EDNRB (NP_001116131.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EDNRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EDNRB (NP_001116131.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00500A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EDNRB |
| Target Synonyms | ETB; ET-B; ETB1; ETBR; ETRB; HSCR; WS4A; ABCDS; ET-BR; HSCR2; EDNRB | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | B cells, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EDNRB (NP_001116131.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF | Uniprot ID | P24530 |
Uniprot Id
P24530
Target Species
Human
Target Name
EDNRB
Target Full Name
Endothelin receptor type B
Target Function
Non-specific receptor for endothelin 1, 2, and 3. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Target Involvement
Waardenburg syndrome 4A (WS4A); Hirschsprung disease 2 (HSCR2); ABCD syndrome (ABCDS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRB sub-subfamily
Target Tissue Specificity
Expressed in placental stem villi vessels, but not in cultured placental villi smooth muscle cells.
Target Synonyms
EDNRB; ETRB; Endothelin receptor type B; ET-B; ET-BR; Endothelin receptor non-selective type
Target Background
The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
