-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EEF1E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEF1E1 (NP_004271.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EEF1E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEF1E1 (NP_004271.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05113A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EEF1E1 |
| Target Synonyms | P18; AIMP3; EEF1E1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEF1E1 (NP_004271.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS | Uniprot ID | O43324 |
Uniprot Id
O43324
Target Species
Human
Target Name
EEF1E1
Target Full Name
Eukaryotic translation elongation factor 1 epsilon-1
Target Function
Positive modulator of ATM response to DNA damage.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytosol. Nucleus. Note=Cytoplasmic under growth arrest conditions. Translocated into the nucleus when growth resumes (S phase) and following DNA damage.
Target Tissue Specificity
Down-regulated in various cancer tissues.
Target Research Area
Metabolism
Target Synonyms
AIMP 3; AIMP3; Aminoacyl tRNA synthetase complex interacting multifunctional protein 3; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS interacting multifunctional protein 3; EEF1E1; Elongation factor p18; Eukaryotic translation elongation factor 1 epsilon 1; Eukaryotic translation elongation factor 1 epsilon-1; Homolog of rat elongation factor p18; MCA3_HUMAN; Multisynthase complex auxiliary component p18; Multisynthetase complex auxiliary component p18; p18; p18 component of aminoacyl tRNA synthetase complex
Target Background
This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.
Notification