-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EFNB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-226 of human EFNB3 (NP_001397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EFNB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-226 of human EFNB3 (NP_001397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04238A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EFNB3 |
| Target Synonyms | EFL6; EPLG8; LERK8; EFNB3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-1080, SH-SY5Y, SKOV3, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-226 of human EFNB3 (NP_001397.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMP | Uniprot ID | Q15768 |
Uniprot Id
Q15768
Target Species
Human
Target Name
EFNB3
Target Full Name
Ephrin-B3
Target Function
Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.; (Microbial infection) Acts as a receptor for nipah virus and hendra virus.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Ephrin family
Target Tissue Specificity
Highly expressed in brain; expressed in embryonic floor plate, roof plate and hindbrain segments.
Target Synonyms
EFL 6; EFL6; EFNB 3; Efnb3; EFNB3_HUMAN; EPH related receptor transmembrane ligand ELK L3; EPH related receptor transmembrane ligand ELKL3; EPH related receptor tyrosine kinase ligand 8; EPH-related receptor transmembrane ligand ELK-L3; EPH-related receptor tyrosine kinase ligand 8; Ephrin B3; Ephrin-B3; EphrinB3; EPLG 8; EPLG8; LERK 8; LERK-8; LERK8
Target Background
EFNB3, a member of the ephrin gene family, is important in brain development as well as in its maintenance. Moreover, since levels of EFNB3 expression were particularly high in several forebrain subregions compared to other brain subregions, it may play a pivotal role in forebrain function. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH Receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Notification