-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-200 of human ELN (NP_001265868.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ELN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-200 of human ELN (NP_001265868.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12044A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELN |
| Target Synonyms | WS; WBS; SVAS; ADCL1; ELN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-200 of human ELN (NP_001265868.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQP | Uniprot ID | P15502 |
Uniprot Id
P15502
Target Species
Human
Target Name
ELN
Target Full Name
Elastin
Target Function
Major structural protein of tissues such as aorta and nuchal ligament, which must expand rapidly and recover completely. Molecular determinant of the late arterial morphogenesis, stabilizing arterial structure by regulating proliferation and organization of vascular smooth muscle.
Target Involvement
Cutis laxa, autosomal dominant, 1 (ADCL1); Supravalvular aortic stenosis (SVAS)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Elastin family
Target Tissue Specificity
Expressed within the outer myometrial smooth muscle and throughout the arteriolar tree of uterus (at protein level). Also expressed in the large arteries, lung and skin.
Target Research Area
Cardiovascular
Target Synonyms
Elastin; ELN; ELN_HUMAN; SVAS ; Tropoelastin; WBS; WS
Target Background
This gene encodes a protein that is one of the two components of elastic fibers. Elastic fibers comprise part of the extracellular matrix and confer elasticity to organs and tissues including the heart, skin, lungs, ligaments, and blood vessels. The encoded protein is rich in hydrophobic amino acids such as glycine and proline, which form mobile hydrophobic regions bounded by crosslinks between lysine residues. Degradation products of the encoded protein, known as elastin-derived peptides or elastokines, bind the elastin receptor complex and other receptors and stimulate migration and proliferation of monocytes and skin fibroblasts. Elastokines can also contribute to cancer progression. Deletions and mutations in this gene are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa.
Notification