-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EMILIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 817-1016 of human EMILIN1 (NP_008977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EMILIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 817-1016 of human EMILIN1 (NP_008977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03944A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EMILIN1 |
| Target Synonyms | EMI; HMN10; gp115; EMILIN; EMILIN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 817-1016 of human EMILIN1 (NP_008977.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEAGPPGPPGLQGPPGPAGPPGSPGKDGQEGPIGPPGPQGEQGVEGAPAAPVPQVAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNQGVARVDSGGYEPEGLENKPVAESQPSPGTLGVFSLILPLQAGDTVCVDLVMGQLAHSEEPLTIFSGALLYGDPELEHA | Uniprot ID | Q9Y6C2 |
Uniprot Id
Q9Y6C2
Target Species
Human
Target Name
EMILIN1
Target Full Name
EMILIN-1
Target Function
May be responsible for anchoring smooth muscle cells to elastic fibers, and may be involved not only in the formation of the elastic fiber, but also in the processes that regulate vessel assembly. Has cell adhesive capacity.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Tissue Specificity
Distributed in tissues where resilience and elastic recoil are prominent. Highest levels in the adult small intestine, aorta, lung, uterus, and appendix and in the fetal spleen, kidney, lung, and heart; intermediate expression was detected in adult liver,
Target Synonyms
Elastin microfibril interface located protein 1; Elastin microfibril interface located protein; Elastin microfibril interface-located protein 1; Elastin microfibril interfacer 1; EMIL1_HUMAN; EMILIN 1; EMILIN; EMILIN-1; Emilin1; gp115
Target Background
This gene encodes an extracellular matrix glycoprotein that is characterized by an N-terminal microfibril interface domain, a coiled-coiled alpha-helical domain, a collagenous domain and a C-terminal globular C1q domain. The encoded protein associates with elastic fibers at the interface between elastin and microfibrils and may play a role in the development of elastic tissues including large blood vessels, dermis, heart and lung.
Notification