Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Endomucin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human Endomucin (NP_057326.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Endomucin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human Endomucin (NP_057326.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01277A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Endomucin |
| Target Synonyms | EMCN2; MUC14; Endomucin | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human Endomucin (NP_057326.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTT | Uniprot ID | Q9ULC0 |
Uniprot Id
Q9ULC0
Target Species
Human
Target Name
EMCN
Target Full Name
Endomucin
Target Function
Endothelial sialomucin, also called endomucin or mucin-like sialoglycoprotein, which interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Consistently localized to the plasma membrane and less abundantly to Golgi-like perinuclear stacks.; [Isoform 2]: Secreted.
Target Tissue Specificity
Expressed in heart, kidney and lung.
Target Synonyms
EMCN; EMCN2; Endomucin 2; Endomucin; Endomucin-2; Endothelial sialomucin; Gastric cancer antigen Ga34; MUC-14; MUC14; MUCEN_HUMAN; Mucin 14; Mucin-14
Target Background
EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
