Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FSHB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-129 of human FSHB (NP_000501.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FSHB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-129 of human FSHB (NP_000501.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05580A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FSHB |
| Target Synonyms | HH24; FSHB | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-129 of human FSHB (NP_000501.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE | Uniprot ID | P01225 |
Uniprot Id
P01225
Target Species
Human
Target Name
FSHB
Target Full Name
Follitropin subunit beta
Target Function
Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.
Target Involvement
Hypogonadotropic hypogonadism 24 without anosmia (HH24)
Target Subcellular Location
Secreted.
Target Protein Families
Glycoprotein hormones subunit beta family
Target Synonyms
HH24; FSHB
Target Background
The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
