Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GBAS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human GBAS (NP_001474.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GBAS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human GBAS (NP_001474.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Immunofluorescence analysis of L929 cells using GBAS Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-06864A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GBAS |
| Target Synonyms | GBAS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human GBAS (NP_001474.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLF | Uniprot ID | O75323 |
Uniprot Id
O75323
Target Species
Human
Target Name
NIPSNAP2
Target Full Name
Protein NipSnap homolog 2
Target Function
May act as a positive regulator of L-type calcium channels.
Target Subcellular Location
Cytoplasm. Mitochondrion outer membrane.
Target Protein Families
NipSnap family
Target Tissue Specificity
Widely expressed. Most abundant in heart and skeletal muscle.
Target Synonyms
4 nitrophenylphosphatase domain and non neuronal SNAP25 like 2; gbas; Glioblastoma amplified sequence ; Glioblastoma-amplified sequence; NIPS2_HUMAN; Nipsnap homolog 2; NipSnap2; Protein NipSnap homolog 2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
