Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNRNPR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human HNRNPR (NP_005817.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HNRNPR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human HNRNPR (NP_005817.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08572A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNRNPR |
| Target Synonyms | HNRPR; NEDDFSB; hnRNP-R; HNRNPR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HL-60, L-02, Mouse brain, SK-OV-3, U-251 MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human HNRNPR (NP_005817.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK | Uniprot ID | O43390 |
Uniprot Id
O43390
Target Species
Human
Target Name
HNRNPR
Target Full Name
Heterogeneous nuclear ribonucleoprotein R
Target Function
Component of ribonucleosomes, which are complexes of at least 20 other different heterogeneous nuclear ribonucleoproteins (hnRNP). hnRNP play an important role in processing of precursor mRNA in the nucleus.
Target Subcellular Location
Nucleus. Microsome. Nucleus, nucleoplasm. Cytoplasm.
Target Synonyms
FLJ25714; Heterogeneous nuclear ribonucleoprotein R; hnRNP R; hnRNP-R; HNRNPR; HNRPR; HNRPR_HUMAN
Target Background
This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
