-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDH3G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human IDH3G (NP_004126.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IDH3G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human IDH3G (NP_004126.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00690A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDH3G |
| Target Synonyms | H-IDHG; IDH3G | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, NIH/3T3, Rat heart, A-431, HepG2, MCF-7, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human IDH3G (NP_004126.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENT | Uniprot ID | P51553 |
Uniprot Id
P51553
Target Species
Human
Target Name
IDH3G
Target Full Name
Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
Target Function
Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Isocitrate and isopropylmalate dehydrogenases family
Target Research Area
Signal Transduction
Target Synonyms
H IDHG; IDH gamma; IDH3G; IDH3G_HUMAN; Isocitrate dehydrogenase [NAD] subunit gamma; Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; Isocitrate dehydrogenase 3 (NAD+) gamma; Isocitric dehydrogenase; Isocitric dehydrogenase subunit gamma; mitochondrial; NAD (H) specific isocitrate dehydrogenase gamma subunit; NAD(+) specific ICDH; NAD(+)-specific ICDH subunit gamma; NAD+ specific ICDH; OTTHUMP00000025984; OTTHUMP00000025985; OTTHUMP00000025987; OTTHUMP00000025988; OTTHUMP00000214764
Target Background
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined.
Notification