-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL-1 alpha was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 112-271 of human IL-1 alpha (NP_000566.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL-1 alpha was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 112-271 of human IL-1 alpha (NP_000566.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11306A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL-1 alpha |
| Target Synonyms | IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RAW264.7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 112-271 of human IL-1 alpha (NP_000566.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA | Uniprot ID | P01583 |
Uniprot Id
P01583
Target Species
Human
Target Name
IL1A
Target Full Name
Interleukin-1 alpha
Target Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Target Subcellular Location
Cytoplasm. Secreted.
Target Protein Families
IL-1 family
Target Research Area
Immunology
Target Synonyms
BAF; FAF; Hematopoietin 1; Hematopoietin-1; IL 1 alpha; IL 1A; IL-1 alpha; Il-1a; IL1 ALPHA; IL1; IL1A; IL1A_HUMAN; IL1F1; Interleukin 1 alpha; Interleukin-1 alpha; Interleukin1 alpha; LAF; LEM; Preinterleukin 1 alpha; Pro interleukin 1 alpha
Target Background
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.
Notification