Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IVL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 416-585 of human IVL (NP_005538.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IVL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 416-585 of human IVL (NP_005538.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10955A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IVL |
| Target Synonyms | IVL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, Jurkat, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 416-585 of human IVL (NP_005538.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK | Uniprot ID | P07476 |
Uniprot Id
P07476
Target Species
Human
Target Name
IVL
Target Full Name
Involucrin
Target Function
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Target Subcellular Location
Cytoplasm. Note=Constituent of the scaffolding of the cornified envelope.
Target Protein Families
Involucrin family
Target Tissue Specificity
Keratinocytes of epidermis and other stratified squamous epithelia.
Target Synonyms
INVO_HUMAN; Involucrin; IVL
Target Background
Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. This gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and calcyclin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
