-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KL (NP_004786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KL (NP_004786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12700A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KL |
| Target Synonyms | KLA; HFTC3; KL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, DU145, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KL (NP_004786.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL | Uniprot ID | Q9UEF7 |
Uniprot Id
Q9UEF7
Target Species
Human
Target Name
KL
Target Full Name
Klotho
Target Function
May have weak glycosidase activity towards glucuronylated steroids. However, it lacks essential active site Glu residues at positions 239 and 872, suggesting it may be inactive as a glycosidase in vivo. May be involved in the regulation of calcium and phosphorus homeostasis by inhibiting the synthesis of active vitamin D. Essential factor for the specific interaction between FGF23 and FGFR1.; The Klotho peptide generated by cleavage of the membrane-bound isoform may be an anti-aging circulating hormone which would extend life span by inhibiting insulin/IGF1 signaling.
Target Involvement
Tumoral calcinosis, hyperphosphatemic, familial (HFTC)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Apical cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Klotho peptide]: Secreted.
Target Protein Families
Glycosyl hydrolase 1 family, Klotho subfamily
Target Tissue Specificity
Present in cortical renal tubules (at protein level). Soluble peptide is present in serum and cerebrospinal fluid. Expressed in kidney, placenta, small intestine and prostate. Down-regulated in renal cell carcinomas, hepatocellular carcinomas, and in chro
Target Synonyms
Kl; KLOT_HUMAN; Klotho peptide
Target Background
This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes (e.g., arteriosclerosis, osteoporosis, and skin atrophy) seen in CRF. Also, mutations within this protein have been associated with ageing and bone loss.
Notification