-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRPAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human LRPAP1 (P30533) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against LRPAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human LRPAP1 (P30533) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04212A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRPAP1 |
| Target Synonyms | RAP; MRAP; A2RAP; HBP44; MYP23; A2MRAP; alpha-2-MRAP; LRPAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, K-562, THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human LRPAP1 (P30533). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIH | Uniprot ID | P30533 |
Uniprot Id
P30533
Target Species
Human
Target Name
LRPAP1
Target Full Name
Alpha-2-macroglobulin receptor-associated protein
Target Function
Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway.
Target Involvement
Myopia 23, autosomal recessive (MYP23)
Target Subcellular Location
Rough endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment lumen. Golgi apparatus, cis-Golgi network. Golgi apparatus lumen. Endosome lumen. Cell surface.
Target Protein Families
Alpha-2-MRAP family
Target Synonyms
39 kDa receptor-associated protein; A2MRAP; A2RAP; Alpha 2 macroglobulin receptor associated protein; Alpha 2 MRAP; Alpha-2-macroglobulin receptor-associated protein; Alpha-2-MRAP; AMRP_HUMAN; HBP44; Lipoprotein receptor associated protein; Low density lipoprotein receptor related protein associated protein 1; Low density lipoprotein receptor-related protein-associated protein 1; Low density lipoprotein related protein associated protein 1 alpha 2 macroglobulin receptor associated protein; Low density lipoprotein related protein associated protein 1; low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1); Lrpap1; MGC138272; MRAP; MYP23; RAP
Target Background
This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants.
Notification