Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LY86 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human LY86 (NP_004262.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LY86 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human LY86 (NP_004262.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04994A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LY86 |
| Target Synonyms | MD1; MD-1; MMD-1; dJ80N2.1; LY86 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human LY86 (NP_004262.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS | Uniprot ID | O95711 |
Uniprot Id
O95711
Target Species
Human
Target Name
LY86
Target Full Name
Lymphocyte antigen 86
Target Function
May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression.
Target Subcellular Location
Secreted, extracellular space. Note=Associated with CD180 at the cell surface.
Target Tissue Specificity
Highly expressed in B-cells, monocytes and tonsil.
Target Research Area
Immunology
Target Synonyms
BPAD; dJ80N2.1; Ly 86; Ly-86; Ly86; LY86_HUMAN; Lymphocyte antigen 86; Lymphocyte antigen 86 precursor; Major affective disorder 1; MD 1; MD-1; MD1 protein; MD1 RP105 associated ; MMD 1; MMD-1; Protein MD 1; Protein MD-1; RP1-80N2.1
Target Background
Acts upstream of or within positive regulation of lipopolysaccharide-mediated signaling pathway. Predicted to be located in extracellular space.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
