Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LY96 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human LY96 (NP_056179.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LY96 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human LY96 (NP_056179.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04477A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LY96 |
| Target Synonyms | MD2; MD-2; ly-96; ESOP-1; LY96 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human LY96 (NP_056179.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN | Uniprot ID | Q9Y6Y9 |
Uniprot Id
Q9Y6Y9
Target Species
Human
Target Name
LY96
Target Full Name
Lymphocyte antigen 96
Target Function
Binds bacterial lipopolysaccharide (LPS). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS.
Target Subcellular Location
Secreted, extracellular space. Secreted.
Target Research Area
Immunology
Target Synonyms
ESOP 1; ESOP-1; ESOP1 ; LY 96; Ly-96; LY96; LY96_HUMAN; Lymphocyte antigen 96; md 2; MD 2 protein; MD2 protein; Myeloid differentiation protein 2 ; Protein MD 2; Protein MD-2; Protein MD2
Target Background
This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
