-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-420 of human MAZ (NP_001036004.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-420 of human MAZ (NP_001036004.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03333A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAZ |
| Target Synonyms | PUR1; ZF87; Pur-1; SAF-1; SAF-2; SAF-3; Zif87; ZNF801; MAZ | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-420 of human MAZ (NP_001036004.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV | Uniprot ID | P56270 |
Uniprot Id
P56270
Target Species
Human
Target Name
MAZ
Target Full Name
Myc-associated zinc finger protein
Target Function
Transcriptional regulator, potentially with dual roles in transcription initiation and termination.; Binds DNA and functions as a transcriptional activator. Binds to two G/A-rich sites, ME1a1 and ME1a2, within the MYC promoter having greater affinity for the former. Also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.; Binds DNA and functions as a transcriptional activator. Inhibits MAZ isoform 1-mediated transcription.; Binds DNA and functions as a transcriptional activator.
Target Subcellular Location
Nucleus. Note=In brains of Alzheimer disease patients, present in a plaque-like structures.
Target Tissue Specificity
Present in kidney, liver and brain. In the brain, highest levels are found in motor cortex and midfrontal cortex (at protein level).; [Isoform 1]: Expressed in the heart, brain, placenta, lung, liver, skeletal muscle and weakly expressed in the kidney. Ex
Target Synonyms
MAZ; MAZ_HUMAN; MAZI; MYC associated zinc finger protein ; Myc-associated zinc finger protein; Pur-1; Pur1; Purine binding transcription factor ; Purine-binding transcription factor; SAF 1; SAF 2; SAF-1; SAF-2; SAF-3; Serum amyloid A activating factor 1; Serum amyloid A activating factor 2; Transcription factor Zif87; ZF87; Zif87; Zinc finger protein 801; Zinc finger protein, 87 kilodaltons; ZNF801
Target Background
Enables DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in several processes, including regulation of gene expression; regulation of signal transduction; and transcription by RNA polymerase II. Predicted to be located in cytoplasm and nucleus.
Notification