Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-115 of human MLN (NP_002409.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MLN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-115 of human MLN (NP_002409.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03056A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLN |
| Target Synonyms | MLN; motilin | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, MCF7, Mouse intestine, Mouse stomach, SGC-7901 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-115 of human MLN (NP_002409.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK | Uniprot ID | P12872 |
Uniprot Id
P12872
Target Species
Human
Target Name
MLN
Target Full Name
Promotilin
Target Function
Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Target Subcellular Location
Secreted.
Target Protein Families
Motilin family
Target Research Area
Signal Transduction
Target Synonyms
MAP; MGC138519; MLN; MOTI_HUMAN; Motilin-associated peptide; Promotilin
Target Background
This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Three transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
