-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYRF (NP_001120864.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYRF (NP_001120864.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11663A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYRF |
| Target Synonyms | MRF; CUGS; MMERV; Ndt80; 11orf9; pqn-47; C11orf9; MYRF | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYRF (NP_001120864.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYSHGQPAMPGSSGVHHLSPPGGGPSPGRHGPLPPPGYGTPLN | Uniprot ID | Q9Y2G1 |
Uniprot Id
Q9Y2G1
Target Species
Human
Target Name
MYRF
Target Full Name
Myelin regulatory factor
Target Function
Constitutes a precursor of the transcription factor. Mediates the autocatalytic cleavage that releases the Myelin regulatory factor, N-terminal component that specifically activates transcription of central nervous system (CNS) myelin genes.; Membrane-bound part that has no transcription factor activity and remains attached to the endoplasmic reticulum membrane following cleavage.; Transcription factor that specifically activates expression of myelin genes such as MBP, MOG, MAG, DUSP15 and PLP1 during oligodendrocyte (OL) maturation, thereby playing a central role in oligodendrocyte maturation and CNS myelination. Specifically recognizes and binds DNA sequence 5'-CTGGYAC-3' in the regulatory regions of myelin-specific genes and directly activates their expression. Not only required during oligodendrocyte differentiation but is also required on an ongoing basis for the maintenance of expression of myelin genes and for the maintenance of a mature, viable oligodendrocyte phenotype.
Target Subcellular Location
[Myelin regulatory factor]: Endoplasmic reticulum membrane; Single-pass membrane protein.; [Myelin regulatory factor, N-terminal]: Nucleus. Cytoplasm.; [Myelin regulatory factor, C-terminal]: Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
MRF family
Target Tissue Specificity
Expressed in lung, ARPE-19 cell line, brainstem, uterus and, to a lesser extent, in basal ganglion and liver. Weakly expressed in cerebellum and retina.
Target Synonyms
C11orf9; Chromosome 11 open reading frame 9; GM1804; GM98; KIAA0954; MGC10781; MRF; MRF_HUMAN; Myelin gene regulatory factor; Ndt80
Target Background
This gene encodes a transcription factor that is required for central nervous system myelination and may regulate oligodendrocyte differentiation. It is thought to act by increasing the expression of genes that effect myelin production but may also directly promote myelin gene expression. Loss of a similar gene in mouse models results in severe demyelination. Alternative splicing results in multiple transcript variants.
Notification