Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAPB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human NAPB (NP_071363.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAPB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human NAPB (NP_071363.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10556A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAPB |
| Target Synonyms | SNAPB; DEE107; SNAP-BETA; NAPB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human NAPB (NP_071363.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN | Uniprot ID | Q9H115 |
Uniprot Id
Q9H115
Target Species
Human
Target Name
NAPB
Target Full Name
Beta-soluble NSF attachment protein
Target Function
Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
Target Subcellular Location
Membrane; Peripheral membrane protein.
Target Protein Families
SNAP family
Target Synonyms
NAPB; SNAPB; Beta-soluble NSF attachment protein; SNAP-beta; N-ethylmaleimide-sensitive factor attachment protein beta
Target Background
This gene encodes a member of the soluble N-ethyl-maleimide-sensitive fusion attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. This gene encodes the SNAP beta isoform which has been shown to be preferentially expressed in brain tissue. The encoded protein also interacts with the GluR2 α-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) receptor subunit C-terminus and may play a role as a chaperone in the molecular processing of the AMPA receptor.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
