-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NBS1/NBN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 650-750 of human NBS1/NBS1/NBN (NP_002476.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NBS1/NBN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 650-750 of human NBS1/NBS1/NBN (NP_002476.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11643A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NBS1/NBN |
| Target Synonyms | ATV; NBS; P95; NBS1; AT-V1; AT-V2; NBS1/NBN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Jurkat, MCF7, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human NBS1/NBS1/NBN (NP_002476.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYL | Uniprot ID | O60934 |
Uniprot Id
O60934
Target Species
Human
Target Name
NBN
Target Full Name
Nibrin
Target Function
Component of the MRE11-RAD50-NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11. RAD50 may be required to bind DNA ends and hold them in close proximity. NBN modulate the DNA damage signal sensing by recruiting PI3/PI4-kinase family members ATM, ATR, and probably DNA-PKcs to the DNA damage sites and activating their functions. It can also recruit MRE11 and RAD50 to the proximity of DSBs by an interaction with the histone H2AX. NBN also functions in telomere length maintenance by generating the 3' overhang which serves as a primer for telomerase dependent telomere elongation. NBN is a major player in the control of intra-S-phase checkpoint and there is some evidence that NBN is involved in G1 and G2 checkpoints. The roles of NBS1/MRN encompass DNA damage sensor, signal transducer, and effector, which enable cells to maintain DNA integrity and genomic stability. Forms a complex with RBBP8 to link DNA double-strand break sensing to resection. Enhances AKT1 phosphorylation possibly by association with the mTORC2 complex.
Target Involvement
Nijmegen breakage syndrome (NBS); Breast cancer (BC); Aplastic anemia (AA)
Target Subcellular Location
Nucleus. Nucleus, PML body. Chromosome, telomere. Chromosome.
Target Tissue Specificity
Ubiquitous. Expressed at high levels in testis.
Target Synonyms
AT V1; AT V2; ATV; Cell cycle regulatory protein p95; FLJ10155; MGC87362; Nbn; NBN_HUMAN; NBS 1; NBS; NBS1; Nibrin; Nijmegen breakage syndrome 1 (nibrin); Nijmegen breakage syndrome; Nijmegen breakage syndrome protein 1; p95; p95 protein of the MRE11/RAD50 complex
Target Background
Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.
Notification