-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCAM1 / CD56 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NCAM1 / CD56 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12699A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCAM1 / CD56 |
| Target Synonyms | CD56; NCAM; MSK39; NCAM1 / CD56 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA | Uniprot ID | P13591 |
Uniprot Id
P13591
Target Species
Human
Target Name
NCAM1
Target Full Name
Neural cell adhesion molecule 1
Target Function
This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.; (Microbial infection) Acts as a receptor for rabies virus.; (Microbial infection) Acts as a receptor for Zika virus.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 4]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 5]: Secreted.; [Isoform 6]: Secreted.
Target Research Area
Neuroscience
Target Synonyms
antigen MSK39 identified by monoclonal 5.1H11; antigen recognized by monoclonal 5.1H11; CD56; cell adhesion molecule, neural, 1; MSK 39; MSK39; N-CAM-1; NCAM 1; NCAM; NCAM C; NCAM-1; NCAM1; NCAM1_HUMAN; NCAMC; Neural cell adhesion molecule 1; Neural cell adhesion molecule NCAM; OTTHUMP00000235666
Target Background
This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein plays a role in the development of the nervous system by regulating neurogenesis, neurite outgrowth, and cell migration. This protein is also involved in the expansion of T lymphocytes, B lymphocytes and natural killer (NK) cells which play an important role in immune surveillance. This protein plays a role in signal transduction by interacting with fibroblast growth factor receptors, N-cadherin and other components of the extracellular matrix and by triggering signalling cascades involving FYN-focal adhesion kinase (FAK), mitogen-activated protein kinase (MAPK), and phosphatidylinositol 3-kinase (PI3K). One prominent isoform of this gene, cell surface molecule CD56, plays a role in several myeloproliferative disorders such as acute myeloid leukemia and differential expression of this gene is associated with differential disease progression. For example, increased expression of CD56 is correlated with lower survival in acute myeloid leukemia patients whereas increased severity of COVID-19 is correlated with decreased abundance of CD56-expressing NK cells in peripheral blood. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms.
Notification