Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-530 of human NDC1 (NP_060557.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-530 of human NDC1 (NP_060557.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10521A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDC1 |
| Target Synonyms | NET3; TMEM48; NDC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Jurkat, MCF7, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 340-530 of human NDC1 (NP_060557.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVEPKKLNSPEETAFQTPKSSQMPRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIK | Uniprot ID | Q9BTX1 |
Uniprot Id
Q9BTX1
Target Species
Human
Target Name
NDC1
Target Full Name
Nucleoporin NDC1
Target Function
Component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. Required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.
Target Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein. Note=Central core structure of the nuclear pore complex.
Target Protein Families
NDC1 family
Target Synonyms
NDC1; TMEM48; Nucleoporin NDC1; hNDC1; Transmembrane protein 48
Target Background
A structural constituent of nuclear pore. Involved in nuclear pore complex assembly and nuclear pore localization. Located in actin cytoskeleton; nuclear membrane; and plasma membrane. Part of nuclear pore.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
