-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLRP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 157-256 of human NLRP5 (NP_703148.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLRP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 157-256 of human NLRP5 (NP_703148.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00880A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLRP5 |
| Target Synonyms | MATER; NALP5; PAN11; PYPAF8; CLR19.8; NLRP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 157-256 of human NLRP5 (NP_703148.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TMTDQGPSKEKVPGISQAVQQDSATAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENT | Uniprot ID | P59047 |
Uniprot Id
P59047
Target Species
Human
Target Name
NLRP5
Target Full Name
NACHT, LRR and PYD domains-containing protein 5
Target Function
As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics. Required for the formation of F-actin cytoplasmic lattices (CPL) in oocytes, which in turn are responsible for symmetric division of zygotes via the regulation of mitotic spindle formation and positioning. Required for the localization of cortical granules to the cortex of oocytes, via association with the cortical actin scaffold. Required for cortical actin clearance prior to oocyte exocytosis. Involved in regulating post-fertilization Ca(2+) release and endoplasmic reticulum (ER) storage via regulation of ER localization. May be involved in the localization of mitochondria to the cytoplasm and perinuclear region in oocytes and early stage embryos, independent of its role in CPL formation
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, Cortical granule. Mitochondrion. Nucleus, nucleolus. Cytoplasm. Golgi apparatus.
Target Protein Families
NLRP family
Target Tissue Specificity
Expressed in cumulus cells (at protein level). Highly abundant in oocytes and early embryos, however poorly expressed in somatic tissues such as the liver and spinal cord.
Target Synonyms
CLR19.8; MATER; Mater protein homolog; Maternal antigen that embryos require; NACHT, leucine rich repeat and PYD containing 5; NACHT, LRR and PYD domains-containing protein 5; NALP5_HUMAN; NLR family, pyrin domain containing 5; NLRP5; Nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 5; PAN11; PYPAF8
Notification